PDB entry 1v30

View 1v30 on RCSB PDB site
Description: Crystal Structure Of Uncharacterized Protein PH0828 From Pyrococcus horikoshii
Class: structural genomics, unknown function
Keywords: alpha+beta, structural genomics, unknown function
Deposited on 2003-10-21, released 2004-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.217
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0131 protein PH0828
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O58558 (Start-115)
      • expression tag (116-123)
    Domains in SCOPe 2.08: d1v30a1, d1v30a2
  • Heterogens: NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v30A (A:)
    msykeksvriavygtlrkgkplhwylkgakflgedwiegyqlyfeylpyavkgkgklkve
    vyevdketferineieigtgyrlvevstkfgkaflwewgskprgkriksgdfdeirlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v30A (A:)
    svriavygtlrkgkplhwylkgakflgedwiegyqlyfeylpyavkgkgklkvevyevdk
    etferineieigtgyrlvevstkfgkaflwewgskprgkriksgdfdeirlehhhhhh