PDB entry 1v2z

View 1v2z on RCSB PDB site
Description: Crystal structure of the C-terminal domain of Thermosynechococcus elongatus BP-1 KaiA
Class: circadian clock protein
Keywords: ALL ALPHA, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, circadian clock protein
Deposited on 2003-10-20, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.227
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Circadian clock protein KaiA homolog
    Species: THERMOSYNECHOCOCCUS ELONGATUS [TaxId:197221]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RR35 (1-End)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1v2za1, d1v2za2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2zA (A:)
    stafffrrmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqv
    leihvelmdtfskqlklegrsedilldyrltlidviahlcemyrrsiprev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2zA (A:)
    stafffrrmspadkrklldelrsiyrtivleyfntdakvneridefvskaffadisvsqv
    leihvelmdtfskqlklegrsedilldyrltlidviahlcemyrrs