PDB entry 1v2y

View 1v2y on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical Gene (RIKEN cDNA 3300001G02) Product Homologous to Ubiquitin Fold
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-10-17, released 2004-04-17
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-17, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3300001G02Rik protein
    Species: MUS MUSCULUS
    Gene: RIKEN cDNA 3300001G02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VIK1 (7-98)
      • cloning artifact (0-6)
      • cloning artifact (99-104)
    Domains in SCOP 1.73: d1v2ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v2yA (A:)
    gssgssgmtvrvckmdgevmpvvvvqnatvldlkkaiqryvqlkqereggvqhiswsyvw
    rtyhltsagekltedrkklrdygirnrdevsfikklgqksgpssg