PDB entry 1v2y

View 1v2y on RCSB PDB site
Description: solution structure of mouse hypothetical gene (riken cdna 3300001g02) product homologous to ubiquitin fold
Deposited on 2003-10-17, released 2004-04-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-04-17, with a file datestamp of 2004-04-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1v2ya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v2yA (A:)
  gssgssgmtvrvckmdgevmpvvvvqnatvldlkkaiqryvqlkqereggvqhiswsyvw
  rtyhltsagekltedrkklrdygirnrdevsfikklgqksgpssg