PDB entry 1v2y

View 1v2y on RCSB PDB site
Description: Solution Structure of Mouse Hypothetical Gene (RIKEN cDNA 3300001G02) Product Homologous to Ubiquitin Fold
Class: structural genomics, unknown function
Keywords: Hypothetical protein, Ubiquitin-like fold, Structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-10-17, released 2004-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3300001G02Rik protein
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 3300001G02
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VIK1 (7-98)
      • cloning artifact (0-6)
      • cloning artifact (99-104)
    Domains in SCOPe 2.08: d1v2ya1, d1v2ya2, d1v2ya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v2yA (A:)
    gssgssgmtvrvckmdgevmpvvvvqnatvldlkkaiqryvqlkqereggvqhiswsyvw
    rtyhltsagekltedrkklrdygirnrdevsfikklgqksgpssg