PDB entry 1v2x

View 1v2x on RCSB PDB site
Description: trmh
Deposited on 2003-10-17, released 2004-05-04
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.225
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v2xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2xA (A:)
    mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggv
    ptfnetsggshkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavl
    fgaekwgvseealaladgaikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprld
    pelyqkvladwlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2xA (A:)
    mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggv
    ptfnetsggshkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavl
    fgaekwgvseealaladgaikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprld
    pelyqkvladw