PDB entry 1v2x

View 1v2x on RCSB PDB site
Description: TrmH
Class: transferase
Keywords: deep trefoil knot, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, transferase
Deposited on 2003-10-17, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.225
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (Gm18) methyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v2xa_
  • Heterogens: PO4, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2xA (A:)
    mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggv
    ptfnetsggshkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavl
    fgaekwgvseealaladgaikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprld
    pelyqkvladwlrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2xA (A:)
    mrertearrrrieevlrrrqpdltvllenvhkphnlsailrtcdavgvleahavnptggv
    ptfnetsggshkwvylrvhpdlheafrflkergftvyatalredardfrevdytkptavl
    fgaekwgvseealaladgaikipmlgmvqslnvsvaaavilfeaqrqrlkaglydrprld
    pelyqkvladw