PDB entry 1v2o

View 1v2o on RCSB PDB site
Description: trypsin inhibitor in complex with bovine trypsin variant x(ssyi)bt.b4
Deposited on 2003-10-17, released 2004-06-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.183
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Domains in SCOP 1.71: d1v2ot_

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v2oT (T:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassyiitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn