PDB entry 1v2l

View 1v2l on RCSB PDB site
Description: benzamidine in complex with bovine trypsin variant x(triple.glu)bt.d1
Deposited on 2003-10-17, released 2004-06-01
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Domains in SCOP 1.69: d1v2lt_

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v2lT (T:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgegcaqknkpgvytkvcnyvswikqtiasn