PDB entry 1v2k

View 1v2k on RCSB PDB site
Description: Factor XA specific Inhibitor in complex with bovine trypsin variant X(triple.Glu)bT.D2
Class: hydrolase
Keywords: serine protease, hydrolase, serine proteinase
Deposited on 2003-10-17, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • engineered (78)
      • engineered (80)
      • engineered (151-154)
      • engineered (171)
      • engineered (194)
    Domains in SCOPe 2.07: d1v2kt_
  • Heterogens: SO4, CA, ZEN, HOH

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v2kT (T:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsetynndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassfiitsnmfcagyleggkdacqgdsggp
vvcsgklqgivswgegcaqknkpgvytkvcnyvswikqtiasn