PDB entry 1v2j

View 1v2j on RCSB PDB site
Description: benzamidine in complex with bovine trypsin variant x(ssri)bt.c1
Deposited on 2003-10-17, released 2004-06-01
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-01, with a file datestamp of 2004-06-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'T':
    Domains in SCOP 1.71: d1v2jt_

PDB Chain Sequences:

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1v2jT (T:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksassriitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn