PDB entry 1v2i

View 1v2i on RCSB PDB site
Description: Structure of the hemagglutinin-neuraminidase from human parainfluenza virus type III
Class: hydrolase
Keywords: PIV3 HN, native, orthorhombic, hydrolase
Deposited on 2003-10-16, released 2004-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed):
    • GB AAP35240 (0-430)
    Domains in SCOPe 2.07: d1v2ia_
  • Chain 'B':
    Compound: hemagglutinin-neuraminidase glycoprotein
    Species: Human parainfluenza virus 3 [TaxId:11216]
    Database cross-references and differences (RAF-indexed):
    • GB AAP35240 (0-430)
    Domains in SCOPe 2.07: d1v2ib_
  • Heterogens: NDG, NAG, CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v2iA (A:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v2iB (B:)
    ithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcirtpslvindl
    iyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslall
    ntdvyqlcstpkvdersdyaspgiedivldivnydgsisttrfknnnisfdqpyaalyps
    vgpgiyykgkiiflgygglehpinenvicnttgcpgktqrdcnqashspwfsdrrmvnsi
    ivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditd
    ysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqks
    rvnpvitystatervnelailnrtlsagytttscithynkgycfhiveinhkslntlqpm
    lfkteipkscs