PDB entry 1v2g

View 1v2g on RCSB PDB site
Description: The L109P mutant of E. coli Thioesterase I/Protease I/Lysophospholipase L1 (TAP) in complexed with octanoic acid
Class: hydrolase
Keywords: SGNH-hydrolase fold
Deposited on 2003-10-15, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-06, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.225
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA Thioesterase I
    Species: Escherichia coli [TaxId:562]
    Gene: tesA, apeA, pldC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29679 (0-End)
      • engineered (108)
    Domains in SCOPe 2.07: d1v2ga_
  • Heterogens: SO4, IMD, OCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2gA (A:)
    adtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkq
    hqprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrrynea
    fsaiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvnh
    dslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2gA (A:)
    adtllilgdslsagyrmsasaawpallndkwsktsvvnasisgdtsqqglarlpallkqh
    qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirppanygrryneaf
    saiypklakefdvpllpffmeevylkpqwmqddgihpnrdaqpfiadwmakqlqplvn