PDB entry 1v2f

View 1v2f on RCSB PDB site
Description: Crystal Structure of T.th HB8 Glutamine Aminotransferase complex with 3-phenylpropionate
Class: transferase
Keywords: transferase, PLP, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-10-15, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.188
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamine Aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v2fa_
  • Chain 'B':
    Compound: Glutamine Aminotransferase
    Species: Thermus thermophilus [TaxId:274]
    Gene: HB8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v2fb_
  • Heterogens: PLP, HCI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2fA (A:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrvvnspreaeggavsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2fA (A:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v2fB (B:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrvvnspreaeggavsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2fB (B:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrv