PDB entry 1v2e

View 1v2e on RCSB PDB site
Description: Crystal Structure of T.th HB8 Glutamine Aminotransferase complex with a-keto-g-methylthiobutyrate
Deposited on 2003-10-15, released 2004-07-06
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-06, with a file datestamp of 2004-07-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v2ea_
  • Chain 'B':
    Domains in SCOP 1.71: d1v2eb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2eA (A:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrvvnspreaeggavsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2eA (A:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v2eB (B:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrvvnspreaeggavsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2eB (B:)
    mrlhprteaakesifprmsglaqrlgavnlgqgfpsnppppflleavrralgrqdqyapp
    aglpalrealaeefavepesvvvtsgatealyvllqslvgpgdevvvlepffdvylpdaf
    lagakarlvrldltpegfrldlsalekaltprtralllntpmnptglvfgereleaiarl
    arahdlflisdevydelyygerprrlrefapertftvgsagkrleatgyrvgwivgpkef
    mprlagmrqwtsfsaptplqagvaealklarregfyealregyrrrrdllagglramglr
    vyvpegtyflmaelpgwdafrlveearvalipasafyledppkdlfrfafckteeelhla
    lerlgrv