PDB entry 1v29

View 1v29 on RCSB PDB site
Description: Crystal structure of Nitrile hydratase from a thermophile Bacillus smithii
Class: lyase
Keywords: NHase, Bacillus smithii
Deposited on 2003-10-09, released 2004-10-09
The last revision prior to the SCOP 1.73 freeze date was dated 2004-10-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.185
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrile hydratase a chain
    Species: Bacillus smithii
    Domains in SCOP 1.73: d1v29a_
  • Chain 'B':
    Compound: nitrile hydratase b chain
    Species: Bacillus smithii
    Domains in SCOP 1.73: d1v29b_
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v29A (A:)
    maieqklmddhhevdprfphhhprpqsfwearakaleslliekrllssdaiervikhyeh
    elgpmngakvvakawtdpefkqrlledpetvlrelgyfglqgehirvventdtvhnvvvc
    tlcscypwpllglppswykepayrsrvvkeprkvlqefgldlpdsveirvwdsssevrfm
    vlpqrpegtegmteeelaqivtrdsmigvakvqppkviqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v29A (A:)
    dprfphhhprpqsfwearakaleslliekrllssdaiervikhyehelgpmngakvvaka
    wtdpefkqrlledpetvlrelgyfglqgehirvventdtvhnvvvctlcscypwpllglp
    pswykepayrsrvvkeprkvlqefgldlpdsveirvwdsssevrfmvlpqrpegtegmte
    eelaqivtrdsmigvakvqppkv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v29B (B:)
    mngihdvggmdgfgkimyvkeeedtyfkhdwerltfglvagcmaqglgmkafdefrigie
    kmrpvdyltssyyghwiatvaynlletgvldekeledrtqafmekpdtkiqrwenpklvk
    vvekalleglspvrevssfprfevgeriktrnihptghtrfpryvrdkygvieevygahv
    fpddaahrkgenpqylyrvrfdaeelwgvkqndsvyidlwegylepvsh