PDB entry 1v27

View 1v27 on RCSB PDB site
Description: Solution structure of the first C2 domain of RIM2
Class: endocytosis/exocytosis
Keywords: C2, exocytosis, Rab3-interacting molecule, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-10-07, released 2004-04-07
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-07, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulating synaptic membrane exocytosis protein 2
  Species: HOMO SAPIENS
  Gene: Kazusa cDNA KIAA0751
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UQ26 (7-134)
    • cloning artifact (0-6)
    • cloning artifact (135-140)
  Domains in SCOP 1.73: d1v27a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1v27A (A:)
  gssgssggqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkr
  rtktvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieleta
  llddephwyklqthdsgpssg