PDB entry 1v27

View 1v27 on RCSB PDB site
Description: Solution structure of the first C2 domain of RIM2
Deposited on 2003-10-07, released 2004-04-07
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-07, with a file datestamp of 2004-04-07.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1v27a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v27A (A:)
    gssgssggqlsiklwfdkvghqlivtilgakdlpsredgrprnpyvkiyflpdrsdknkr
    rtktvkktlepkwnqtfiyspvhrrefrermleitlwdqarvreeeseflgeilieleta
    llddephwyklqthdsgpssg