PDB entry 1v26

View 1v26 on RCSB PDB site
Description: Crystal structure of tt0168 from Thermus thermophilus HB8
Class: ligase
Keywords: LIGASE, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-10-07, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: long-chain-fatty-acid-CoA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD20228
    Domains in SCOPe 2.08: d1v26a_
  • Chain 'B':
    Compound: long-chain-fatty-acid-CoA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • GB BAD20228 (Start-540)
    Domains in SCOPe 2.08: d1v26b_
  • Heterogens: MG, MYR, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v26A (A:)
    megermnafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrl
    mgglralgvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaed
    kvllfdpnllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacg
    mayttgttglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaa
    tlvgakqvlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvv
    ggsaaprsliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglp
    iplvrlrvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdia
    vwdeegyveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplav
    vvprgekptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v26A (A:)
    afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
    gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
    nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
    tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
    vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
    sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
    vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
    veikdrlkdliksggewissvdlenaavvaiphpkwqerplavvgfakwqlpdaylkral
    reqyknyyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v26B (B:)
    megermnafpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrl
    mgglralgvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaed
    kvllfdpnllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacg
    mayttgttglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaa
    tlvgakqvlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvv
    ggsaaprsliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglp
    iplvrlrvadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdia
    vwdeegyveikdrlkdliksggewissvdlenalmghpkvkeaavvaiphpkwqerplav
    vvprgekptpeelnehllkagfakwqlpdayvfaeeiprtsagkflkralreqyknyygg
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v26B (B:)
    afpstmmdeelnlwdfleraaalfgrkevvsrlhtgevhrttyaevyqrarrlmgglral
    gvgvgdrvatlgfnhfrhleayfavpgmgavlhtanprlspkeiayilnhaedkvllfdp
    nllplveairgelktvqhfvvmdekapegylayeealgeeadpvrvperaacgmayttgt
    tglpkgvvyshralvlhslaaslvdgtalsekdvvlpvvpmfhvnawclpyaatlvgakq
    vlpgprldpaslvelfdgegvtftagvptvwlaladylestghrlktlrrlvvggsaapr
    sliarfermgvevrqgygltetspvvvqnfvkshleslseeekltlkaktglpiplvrlr
    vadeegrpvpkdgkalgevqlkgpwitggyygneeatrsaltpdgffrtgdiavwdeegy
    veikdrlkdliksggewissvdlenaaavvaiphpkwqerplavtpeelnehllkagfak
    wqlpdayvfaeeiprtralreqyknyygga