PDB entry 1v1t

View 1v1t on RCSB PDB site
Description: Crystal structure of the PDZ tandem of human syntenin with TNEYKV peptide
Class: cell adhesion
Keywords: cell adhesion, adhesion-complex, pdz domain, scaffolding protein
Deposited on 2004-04-23, released 2005-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1T (Start-4)
    • Uniprot O00560 (5-165)
    Domains in SCOPe 2.07: d1v1ta1, d1v1ta2, d1v1ta3
  • Chain 'B':
    Compound: Syntenin 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1T (Start-4)
    • Uniprot O00560 (5-End)
    Domains in SCOPe 2.07: d1v1tb1, d1v1tb2, d1v1tb3
  • Chain 'S':
    Compound: tneykv peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1T (Start-5)
  • Chain 'T':
    Compound: tneykv peptide
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1T (Start-5)
  • Heterogens: BEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1tA (A:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1tA (A:)
    mdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagw
    ssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaar
    nglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1tB (B:)
    gamdprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingenca
    gwssdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssa
    arnglltehniceingqnviglkdsqiadilstsgtvvtitimpaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1tB (B:)
    dprevilckdqdgkiglrlksidngifvqlvqanspaslvglrfgdqvlqingencagws
    sdkahkvlkqafgekitmtirdrpfertitmhkdstghvgfifkngkitsivkdssaarn
    glltehniceingqnviglkdsqiadilstsgtvvtitimpa
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    No sequence available.