PDB entry 1v1s

View 1v1s on RCSB PDB site
Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus (crystal form 2)
Class: transferase
Keywords: 2-KETO-3-DEOXYGLUCONATE KINASE, THERMUS THERMOPHILUS, STRUCTURAL GENOMICS, TRANSFERASE, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-04-23, released 2004-04-26
The last revision prior to the SCOP 1.75 freeze date was dated 2004-07-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.239
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1sa_
  • Chain 'B':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1sb_
  • Chain 'C':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1sc_
  • Chain 'D':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1sd_
  • Chain 'E':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1se_
  • Chain 'F':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1v1sf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1sA (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1sA (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1sB (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1sB (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v1sC (C:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1sC (C:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v1sD (D:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1sD (D:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v1sE (E:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1sE (E:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v1sF (F:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1sF (F:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk