PDB entry 1v1q

View 1v1q on RCSB PDB site
Description: crystal structure of prib- a primosomal DNA replication protein of escherichia coli
Class: DNA binding
Keywords: primosome, DNA replication, DNA binding
Deposited on 2004-04-22, released 2004-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: primosomal replication protein n
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07013 (121-End)
      • engineered mutation (119)
    • Uniprot P07013 (17-120)
    Domains in SCOP 1.73: d1v1qa_
  • Chain 'B':
    Compound: primosomal replication protein n
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07013 (121-End)
      • engineered mutation (119)
    • Uniprot P07013 (17-120)
    Domains in SCOP 1.73: d1v1qb_
  • Heterogens: CYS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1qA (A:)
    masmtggqqmgrdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfh
    rqawcqmpvivsghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsv
    dklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1qA (A:)
    pnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvivsg
    henqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdkla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1qB (B:)
    masmtggqqmgrdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfh
    rqawcqmpvivsghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsv
    dklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1qB (B:)
    grdpnslmtnrlvlsgtvcraplrkvspsgiphcqfvlehrsvqeeagfhrqawcqmpvi
    vsghenqaithsitvgsritvqgfischkaknglskmvlhaeqielidsvdk