PDB entry 1v1m

View 1v1m on RCSB PDB site
Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
Class: oxidoreductase
Keywords: oxidoreductase, ketoacid dehydrogenase, branched-chain, multi-enzyme complex, acylation, oxidative decarboxylation maple syrup urine disease, thiamine diphosphate, phosphorylation, flavoprotein
Deposited on 2004-04-20, released 2004-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.13
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v1ma_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v1mb1, d1v1mb2
  • Heterogens: TDP, CL, K, MN, BEN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1mA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighastsadssaf
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1mA (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyrigdhpisrlrhyllsqgw
    wdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqt
    ygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1mB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1mB (B:)
    ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
    drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
    cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
    ffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklg
    vscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleap
    isrvcgydtpfphifepfyipdkwkcydalrkminy