SCOPe 2.01: Structural Classification of Proteins

PDB entry 1v1j

View 1v1j on RCSB PDB site
Description: crystal structure of type II dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro
Class: lyase
Keywords: dhq, shikimate, dehydroquinase, aromatic amino acid biosynthesis, lyase
Deposited on 2004-04-16, released 2005-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21745
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1ja_
Chain 'B':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jb_
Chain 'C':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jc_
Chain 'D':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jd_
Chain 'E':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1je_
Chain 'F':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jf_
Chain 'G':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jg_
Chain 'H':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jh_
Chain 'I':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1ji_
Chain 'J':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jj_
Chain 'K':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jk_
Chain 'L':
Compound: 3-dehydroquinate dehydratase
Species: Streptomyces coelicolor [TaxId:1902]
Database cross-references and differences (RAF-indexed):
- PDB 1V1J
- Uniprot P15474 (1-End)
Domains in SCOPe 2.01: d1v1jl_
Heterogens: FA3, TRS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1v1jA (A:)
mprslanapimilngpnlnllgqrqpeiygsdtladvealcvkaaaahggtvdfrqsnhe
gelvdwihearlnhcgivinpaayshtsvaildalntcdglpvvevhisnihqrepfrhh
syvsqradgvvagcgvqgyvfgveriaalagagsara