PDB entry 1v1h

View 1v1h on RCSB PDB site
Description: Adenovirus fibre shaft sequence N-terminally fused to the bacteriophage T4 fibritin foldon trimerisation motif with a short linker
Class: adenovirus
Keywords: adenovirus, chimera, fiber protein
Deposited on 2004-04-16, released 2004-07-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibritin, fiber protein
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-73)
      • linker (74-75)
      • conflict (97)
    • Uniprot P10104 (76-102)
    Domains in SCOPe 2.07: d1v1ha1, d1v1ha2
  • Chain 'B':
    Compound: fibritin, fiber protein
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-73)
      • conflict (97)
    • Uniprot P10104 (76-102)
    Domains in SCOPe 2.07: d1v1hb1, d1v1hb2
  • Chain 'C':
    Compound: fibritin, fiber protein
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-73)
      • conflict (97)
    • Uniprot P10104 (76-102)
    Domains in SCOPe 2.07: d1v1hc1, d1v1hc2
  • Chain 'D':
    Compound: fibritin, fiber protein
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-73)
      • conflict (97)
    • Uniprot P10104 (76-102)
    Domains in SCOPe 2.07: d1v1hd1, d1v1hd2
  • Chain 'E':
    Compound: fibritin, fiber protein
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-73)
      • linker (74-75)
      • conflict (97)
    • Uniprot P10104 (76-102)
    Domains in SCOPe 2.07: d1v1he1, d1v1he2
  • Chain 'F':
    Compound: fibritin, fiber protein
    Species: Bacteriophage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03275 (0-73)
      • conflict (97)
    • Uniprot P10104 (76-102)
    Domains in SCOPe 2.07: d1v1hf1, d1v1hf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v1hA (A:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1hB (B:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1hB (B:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v1hC (C:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1hC (C:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v1hD (D:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1hD (D:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v1hE (E:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v1hF (F:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggsgyipeaprdgqayvrkdgewvllstfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1hF (F:)
    vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
    aglsfdnsgaitiggyipeaprdgqayvrkdgewvllstfl