PDB entry 1v1c

View 1v1c on RCSB PDB site
Description: solution structure of the sh3 domain of obscurin
Deposited on 2004-04-14, released 2005-04-14
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Obscurin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1C
    • Uniprot Q96AA2 (3-70)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1v1cA (A:)
    gssifdiyvvtadylplgaeqdaitlregqyvevldaahplrwlvrtkptksspsrqgwv
    spayldrrlkl
    

    Sequence, based on observed residues (ATOM records):
    >1v1cA (A:)
    ifdiyvvtadylplgaeqdaitlregqyvevldaahplrwlvrtkptksspsrqgwvspa
    yldrrlkl