PDB entry 1v1a

View 1v1a on RCSB PDB site
Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2-keto-3-deoxygluconate and ADP
Class: transferase
Keywords: 2-keto-3-deoxygluconate kinase, thermus thermophilus, structural genomics, transferase, riken structural genomics/proteomics initiative, rsgi
Deposited on 2004-04-12, released 2004-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1A (0-End)
    Domains in SCOPe 2.07: d1v1aa_
  • Chain 'B':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V1A (0-End)
    Domains in SCOPe 2.07: d1v1ab_
  • Heterogens: KDG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v1aA (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1aA (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v1aB (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v1aB (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk