PDB entry 1v19

View 1v19 on RCSB PDB site
Description: 2-keto-3-deoxygluconate kinase from thermus thermophilus
Class: transferase
Keywords: 2-keto-3-deoxygluconate kinase, thermus thermophilus, structural genomics, transferase, riken structural genomics/proteomics initiative, rsgi
Deposited on 2004-04-12, released 2004-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1529
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V19 (0-End)
    Domains in SCOPe 2.07: d1v19a_
  • Chain 'B':
    Compound: 2-keto-3-deoxygluconate kinase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V19 (0-End)
    Domains in SCOPe 2.07: d1v19b_
  • Heterogens: DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v19A (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v19A (A:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v19B (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lkatqtfmr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v19B (B:)
    mlevvtageplvalvpqepghlrgkrllevyvggaevnvavalarlgvkvgfvgrvgede
    lgamveerlraegvdlthfrrapgftglylreylplgqgrvfyyrkgsagsalapgafdp
    dylegvrflhlsgitpalspearafslwameeakrrgvrvsldvnyrqtlwspeeargfl
    eralpgvdllflseeeaellfgrveealralsapevvlkrgakgawafvdgrrvegsafa
    veavdpvgagdafaagylagavwglpveerlrlanllgasvaasrgdhegapyredlevl
    lk