PDB entry 1v18

View 1v18 on RCSB PDB site
Description: the crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated apc 20mer repeat.
Class: signaling protein
Keywords: signaling protein, signalling complex, wnt signal, beta-catenin degradation complex, cell adhesion, transcription, transcription regulation
Deposited on 2004-04-09, released 2005-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v18a_
  • Chain 'B':
    Compound: adenomatous polyposis coli
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v18A (A:)
    havvnlinyqddaelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspq
    mvsaivrtmqntndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlf
    yaittlhnlllhqegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskl
    iilasggpqalvnimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdp
    sqrlvqnclwtlrnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyk
    nkmmvcqvggiealvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpv
    vvkllhppshwplikatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsm
    ggtqqqfvegvrmeeivegctgalhilardvhnrivirglntiplfvqllyspieniqrv
    aagvlcelaqdkeaaeaieaegatapltellhsrnegvatyaaavlfrmsedkpqdyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v18A (A:)
    traipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqntndve
    tarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllhqega
    kmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalvnimr
    tytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtlrnls
    daatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggiealvr
    tvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwplika
    tvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrqfvegvrmeeivegctgal
    hilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieaegat
    apltellhsrnegvatyaaavlfrmsed
    

  • Chain 'B':
    No sequence available.