PDB entry 1v16

View 1v16 on RCSB PDB site
Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
Deposited on 2004-04-07, released 2004-06-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-29, with a file datestamp of 2004-07-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.13221
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v16A (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighastsddssaf
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v16A (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyridhpisrlrhyllsqgww
    deeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqty
    gehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v16B (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v16B (B:)
    ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
    drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
    cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
    ffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklg
    vscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleap
    isrvcgydtpfphifepfyipdkwkcydalrkminy