PDB entry 1v16

View 1v16 on RCSB PDB site
Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
Class: oxidoreductase
Keywords: oxidoreductase, ketoacid dehydrogenase, branched-chain, multi-enzyme complex, acylation, oxidative decarboxylation maple syrup urine disease, thiamine diphosphate, phosphorylation, flavoprotein
Deposited on 2004-04-07, released 2004-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v16a_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v16b1, d1v16b2
  • Heterogens: K, MN, CL, TDP, BEN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v16A (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighastsddssaf
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v16A (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyridhpisrlrhyllsqgww
    deeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqty
    gehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v16B (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v16B (B:)
    ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
    drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
    cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
    ffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklg
    vscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleap
    isrvcgydtpfphifepfyipdkwkcydalrkminy