PDB entry 1v14

View 1v14 on RCSB PDB site
Description: crystal structure of the colicin e9, mutant his103ala, in complex with mg+2 and dsdna (resolution 2.9a)
Class: hydrolase
Keywords: homing endonucleases, colicin, hnh motif, beta-beta-alpha metal motif, hydrolase
Deposited on 2004-04-06, released 2004-06-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: colicin e9
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1V14
      • engineered mutation (102)
    • Uniprot P09883 (1-End)
    Domains in SCOPe 2.07: d1v14a_
  • Chain 'B':
    Compound: colicin e9
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1V14 (0-0)
      • engineered mutation (102)
    • Uniprot P09883 (1-End)
    Domains in SCOPe 2.07: d1v14b_
  • Chain 'C':
    Compound: colicin e9
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1V14
      • engineered mutation (102)
    • Uniprot P09883 (1-End)
    Domains in SCOPe 2.07: d1v14c_
  • Chain 'D':
    Compound: colicin e9
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1V14
      • engineered mutation (102)
    • Uniprot P09883
    Domains in SCOPe 2.07: d1v14d_
  • Chain 'E':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'F':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'G':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'H':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'I':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'J':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'K':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Chain 'L':
    Compound: 5'-d(*gp*cp*gp*ap*tp*cp*gp*cp)-3'
    Species:
    Gene:
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v14A (A:)
    meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
    vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
    vttpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v14A (A:)
    eskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweev
    skdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirv
    ttpkrhidihrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v14B (B:)
    meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
    vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
    vttpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v14B (B:)
    meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
    vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
    vttpkrhidihr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v14C (C:)
    meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
    vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
    vttpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v14C (C:)
    eskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweev
    skdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirv
    ttpkrhidihrg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v14D (D:)
    meskrnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavwee
    vskdpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnir
    vttpkrhidihrgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v14D (D:)
    krnkpgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevsk
    dpelsknlnpsnkssvskgyspftpknqqvggrkvyelhadkpisqggevydmdnirvtt
    pkrhidihrg
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.