PDB entry 1v11

View 1v11 on RCSB PDB site
Description: crosstalk between cofactor binding and the phosphorylation loop conformation in the bckd machine
Class: oxidoreductase
Keywords: oxidoreductase, ketoacid dehydrogenase, branched-chain, multi-enzyme complex, acylation, oxidative decarboxylation, maple syrup urine disease, thiamine phosphate, phosphorylation
Deposited on 2004-04-05, released 2004-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.139
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12694 (Start-399)
      • engineered mutation (286)
    Domains in SCOPe 2.07: d1v11a_
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v11b1, d1v11b2
  • Heterogens: K, MN, CL, TDP, BEN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v11A (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyaighastsddssay
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v11A (A:)
    pqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtl
    lntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdypl
    elfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrv
    vicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgy
    gimsirvdgndvfavynatkearrravaenqpflieamtyaidhpisrlrhyllsqgwwd
    eeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqtyg
    ehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v11B (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v11B (B:)
    ahftfqpeygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygk
    drvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfn
    cgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpci
    ffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklg
    vscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleap
    isrvcgydtpfphifepfyipdkwkcydalrkminy