PDB entry 1v10

View 1v10 on RCSB PDB site
Description: structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
Deposited on 2004-04-02, released 2004-09-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-16, with a file datestamp of 2004-09-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.226
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v10A (A:)
    mpsfaslkslvvlsltslslaatvaldlhilnanldpdgtgarsavtaegttiaplitgn
    iddrfqinvidqltdanmrratsihwhgffqagttemdgpafvnqcpiipnesfvydfvv
    pgqagtywyhshlstqycdglrgafvvydpndphlslydvddastvitiadwyhslstvl
    fpnpnkappapdttlinglgrnsanpsagqlavvsvqsgkryrfrivstscfpnyafsid
    ghrmtvievdgvshqpltvdsltifagqrysvvveanqavgnywiranpsngrngftggi
    nsaifryqgaavaepttsqnsgtalneanliplinpgapgnpvpggadinlnlrigrnat
    tadftingapfipptvpvllqilsgvtnpndllpggavislpanqvieisipgggnhpfh
    lhghnfdvvrtpgssvynyvnpvrrdvvsiggggdnvtfrfvtdnpgpwflhchidwhle
    aglavvfaedipnipianaispawddlcpkynannpdsgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v10A (A:)
    atvaldlhilnanldpdgtgarsavtaegttiaplitgniddrfqinvidqltdanmrra
    tsihwhgffqagttemdgpafvnqcpiipnesfvydfvvpgqagtywyhshlstqycdgl
    rgafvvydpndphlslydvddastvitiadwyhslstkappapdttlinglgrnsanpsa
    gqlavvsvqsgkryrfrivstscfpnyafsidghrmtvievdgvshqpltvdsltifagq
    rysvvveanqavgnywiranpsngrngftgginsaifryqgaavaepttsqnsgtalnea
    nliplinpgapgnpvpggadinlnlrigrnattadftingapfipptvpvllqilsgvtn
    pndllpggavislpanqvieisipgggnhpfhlhghnfdvvrtpgssvynyvnpvrrdvv
    siggggdnvtfrfvtdnpgpwflhchidwhleaglavvfaedipnipianaispawddlc
    pkynann