PDB entry 1v0z

View 1v0z on RCSB PDB site
Description: Structure of Neuraminidase from English duck subtype N6
Class: hydrolase
Keywords: glycosidase, hydrolase
Deposited on 2004-04-02, released 2006-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0za_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0zb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0zc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0zd_
  • Heterogens: CA, GOL, NAG, MAN, BMA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0zA (A:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0zB (B:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0zC (C:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0zD (D:)
    rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
    grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
    asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
    kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
    vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
    naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
    snsivalcgskkrlgswswhdgaeiiyfe