PDB entry 1v0u

View 1v0u on RCSB PDB site
Description: phospholipase d from streptomyces sp. strain pmf soaked with the product glycerophosphate.
Deposited on 2004-04-02, released 2004-06-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-03, with a file datestamp of 2004-06-03.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.16686
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0uA (A:)
    adsatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcad
    rvgtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvg
    aapvyhmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsalt
    gginswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgn
    agcmptmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglh
    dntnadrdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakma
    agvkvrivvsdpanrgavgsggysqikslseisdtlrnrlanitggqqaaktamcsnlql
    atfrsspngkwadghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqld
    aklldpqwkysqetatvdyargicna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0uA (A:)
    satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
    gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgav
    ipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgginswkdd
    yldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnagcmptmhk
    dtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrdy
    dtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakmaagvkvrivv
    sdpanrgysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwadgh
    pyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqeta
    tvdyargicn