PDB entry 1v0s

View 1v0s on RCSB PDB site
Description: uninhibited form of phospholipase d from streptomyces sp. strain pmf
Class: hydrolase
Keywords: phospholipase d, hydrolase, uninhibited
Deposited on 2004-04-01, released 2004-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.153
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase d
    Species: STREPTOMYCES SP. [TaxId:172564]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0S (296-505)
    Domains in SCOPe 2.07: d1v0sa1, d1v0sa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0sA (A:)
    adsatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcad
    rvgtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvg
    aapvyhmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsalt
    gginswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgn
    agcmptmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglh
    dntnadrdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakma
    agvkvrivvsdpanrgavgsggysqikslseisdtlrnrlanitggqqaaktamcsnlql
    atfrsspngkwadghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqld
    aklldpqwkysqetatvdyargicna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0sA (A:)
    satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
    gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgaa
    pmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltggins
    wkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnagcmp
    tmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntna
    drdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakmaagvkv
    rivvsdpanrgysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkw
    adghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkys
    qetatvdyargicna