PDB entry 1v0r

View 1v0r on RCSB PDB site
Description: tungstate-inhibited phospholipase d from streptomyces sp. strain pmf
Class: hydrolase
Keywords: hydrolase, phospholipase d, tungstate-inhibited
Deposited on 2004-04-01, released 2004-06-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.157
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase d
    Species: STREPTOMYCES SP. [TaxId:172564]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0R (296-505)
    Domains in SCOPe 2.04: d1v0ra1, d1v0ra2
  • Heterogens: WO5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0rA (A:)
    adsatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcad
    rvgtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvg
    aapvyhmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsalt
    gginswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgn
    agcmptmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglh
    dntnadrdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakma
    agvkvrivvsdpanrgavgsggysqikslseisdtlrnrlanitggqqaaktamcsnlql
    atfrsspngkwadghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqld
    aklldpqwkysqetatvdyargicna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0rA (A:)
    satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
    gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgaa
    vipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgginswkd
    dyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnagcmptmh
    kdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrd
    ydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakmaagvkvriv
    vsdpanrggysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwad
    ghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqe
    tatvdyargicna