PDB entry 1v0r

View 1v0r on RCSB PDB site
Description: tungstate-inhibited phospholipase d from streptomyces sp. strain pmf
Class: hydrolase
Keywords: hydrolase, phospholipase d, tungstate-inhibited
Deposited on 2004-04-01, released 2004-06-03
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-03, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.15705
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase d
    Species: Streptomyces sp.
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1v0ra1, d1v0ra2
  • Heterogens: WO5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0rA (A:)
    adsatphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcad
    rvgtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvg
    aapvyhmnvipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsalt
    gginswkddyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgn
    agcmptmhkdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglh
    dntnadrdydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakma
    agvkvrivvsdpanrgavgsggysqikslseisdtlrnrlanitggqqaaktamcsnlql
    atfrsspngkwadghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqld
    aklldpqwkysqetatvdyargicna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0rA (A:)
    satphldaveqtlrqvspglegdvwertsgnkldgsaadpsdwllqtpgcwgddkcadrv
    gtkrllakmtenignatrtvdistlapfpngafqdaivaglkesaakgnklkvrilvgaa
    vipskyrdeltaklgkaaenitlnvasmttsktafswnhskilvvdgqsaltgginswkd
    dyldtthpvsdvdlaltgpaagsagryldtlwtwtcqnksniasvwfaasgnagcmptmh
    kdtnpkaspatgnvpviavgglgvgikdvdpkstfrpdlptasdtkcvvglhdntnadrd
    ydtvnpeesalralvasakghieisqqdlnatcpplprydirlydalaakmaagvkvriv
    vsdpanrggysqikslseisdtlrnrlanitggqqaaktamcsnlqlatfrsspngkwad
    ghpyaqhhklvsvdsstfyigsknlypswlqdfgyivespeaakqldaklldpqwkysqe
    tatvdyargicna