PDB entry 1v0p

View 1v0p on RCSB PDB site
Description: structure of p. falciparum pfpk5-purvalanol b ligand complex
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, cdk
Deposited on 2004-04-01, released 2004-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division control protein 2 homolog
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07785 (0-End)
      • engineered mutation (160)
    Domains in SCOPe 2.07: d1v0pa_
  • Chain 'B':
    Compound: cell division control protein 2 homolog
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0pb_
  • Heterogens: PVB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0pA (A:)
    mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
    nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
    vlhrdlkpqnllinregelkiadfglarafgipvrkytheivtlwyrapdvlmgskkyst
    tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
    yeplpwesflkgldesgidllskmlkldpnqritakqalehayfkenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0pA (A:)
    mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
    nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
    vlhrdlkpqnllinregelkiadfglarafgivtlwyrapdvlmgskkysttidiwsvgc
    ifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesf
    lkgldesgidllskmlkldpnqritakqalehayfke
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v0pB (B:)
    mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
    nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
    vlhrdlkpqnllinregelkiadfglarafgipvrkytheivtlwyrapdvlmgskkyst
    tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
    yeplpwesflkgldesgidllskmlkldpnqritakqalehayfkenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0pB (B:)
    ekyhglekigegtygvvykaqnnygetfalkpsttireisilkelkhsnivklydvihtl
    vlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvlhrdlkpqnllinr
    egelkiadfglaraflwyrapdvlmgskkysttidiwsvgcifaemvngtplfpgvsead
    qlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesflkgldesgidllskmlkld
    pnqritakqalehayfke