PDB entry 1v0n

View 1v0n on RCSB PDB site
Description: xylanase xyn10a from streptomyces lividans in complex with xylobio-isofagomine at ph 7.5
Class: hydrolase
Keywords: glycoside hydrolase family 10, xylanase, xylan degradation, deoxynojirimycin, hydrolase
Deposited on 2004-03-31, released 2004-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.104
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0na_
  • Heterogens: EDO, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0nA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0nA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    ng