PDB entry 1v0k

View 1v0k on RCSB PDB site
Description: xylanase xyn10a from streptomyces lividans in complex with xylobio- deoxynojirimycin at ph 5.8
Deposited on 2004-03-31, released 2004-08-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-16, with a file datestamp of 2004-08-16.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.11471
AEROSPACI score: 1.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1v0ka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0kA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0kA (A:)
    estlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnf
    ssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgkiv
    qwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwak
    tqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqg
    apastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldaln
    gg