PDB entry 1v0k

View 1v0k on RCSB PDB site
Description: Xylanase Xyn10A from Streptomyces lividans in complex with xylobio-deoxynojirimycin at pH 5.8
Class: hydrolase
Keywords: glycoside hydrolase family 10, xylanase, xylan degradation, deoxynojirimycin, hydrolase
Deposited on 2004-03-31, released 2004-08-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase A
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1v0ka_
  • Heterogens: XYP, XDN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0kA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
    nggdsseppadgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0kA (A:)
    estlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnf
    ssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgkiv
    qwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwak
    tqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqg
    apastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldaln
    gg