PDB entry 1v0j

View 1v0j on RCSB PDB site
Description: udp-galactopyranose mutase from mycobacterium tuberculosis
Deposited on 2004-03-30, released 2005-01-26
The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactopyranose mutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: udp-galactopyranose mutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: udp-galactopyranose mutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: udp-galactopyranose mutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FAD, BCN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1v0jA (A:)
    mqpmtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievh
    kygahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpe
    qarqliaeqaaeidtadaqnleekaisligrplyeafvkgytakqwqtdpkelpaanitr
    lpvrytfdnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaap
    vvytgpldryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfh
    perdyptdktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggr
    lgtyqyldmhmaiasalnmydnvlaphlrdgvpllqdga
    

    Sequence, based on observed residues (ATOM records):
    >1v0jA (A:)
    mtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievhkyg
    ahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpeqar
    qliaeqaaeidtadeekaisligrplyeafvkgytakqwqtdpkelpaanitrlpvrytf
    dnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaapvvytgpl
    dryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfhperdypt
    dktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggrlgtyqyl
    dmhmaiasalnmydnvlaphlrdgvpll
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1v0jB (B:)
    mqpmtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievh
    kygahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpe
    qarqliaeqaaeidtadaqnleekaisligrplyeafvkgytakqwqtdpkelpaanitr
    lpvrytfdnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaap
    vvytgpldryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfh
    perdyptdktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggr
    lgtyqyldmhmaiasalnmydnvlaphlrdgvpllqdga
    

    Sequence, based on observed residues (ATOM records):
    >1v0jB (B:)
    mtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievhkyg
    ahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpeqar
    qliaeqaaeidtadeekaisligrplyeafvkgytakqwqtdpkelpaanitrlpvrytf
    dnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaapvvytgpl
    dryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfhperdypt
    dktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggrlgtyqyl
    dmhmaiasalnmydnvlaphlrdgvpll
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1v0jC (C:)
    mqpmtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievh
    kygahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpe
    qarqliaeqaaeidtadaqnleekaisligrplyeafvkgytakqwqtdpkelpaanitr
    lpvrytfdnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaap
    vvytgpldryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfh
    perdyptdktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggr
    lgtyqyldmhmaiasalnmydnvlaphlrdgvpllqdga
    

    Sequence, based on observed residues (ATOM records):
    >1v0jC (C:)
    mtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievhkyg
    ahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpeqar
    qliaeqaaeidtadeekaisligrplyeafvkgytakqwqtdpkelpaanitrlpvrytf
    dnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaapvvytgpl
    dryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfhperdypt
    dktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggrlgtyqyl
    dmhmaiasalnmydnvlaphlrdgvpll
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1v0jD (D:)
    mqpmtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievh
    kygahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpe
    qarqliaeqaaeidtadaqnleekaisligrplyeafvkgytakqwqtdpkelpaanitr
    lpvrytfdnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaap
    vvytgpldryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfh
    perdyptdktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggr
    lgtyqyldmhmaiasalnmydnvlaphlrdgvpllqdga
    

    Sequence, based on observed residues (ATOM records):
    >1v0jD (D:)
    mtarfdlfvvgsgffgltiaervatqldkrvlvlerrphiggnayseaepqtgievhkyg
    ahlfhtsnkrvwdyvrqftdftdyrhrvfamhngqayqfpmglglvsqffgkyftpeqar
    qliaeqaaeidtadeekaisligrplyeafvkgytakqwqtdpkelpaanitrlpvrytf
    dnryfsdtyeglptdgytawlqnmaadhrievrlntdwfdvrgqlrpgspaapvvytgpl
    dryfdyaegrlgwrtldfevevlpigdfqgtavmnyndldvpytrihefrhfhperdypt
    dktvimreysrfaedddepyypinteadrallatyraraksetasskvlfggrlgtyqyl
    dmhmaiasalnmydnvlaphlrdgvpll