PDB entry 1v0h

View 1v0h on RCSB PDB site
Description: ascobate peroxidase from soybean cytosol in complex with salicylhydroxamic acid
Deposited on 2004-03-29, released 2004-06-23
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-16, with a file datestamp of 2004-07-16.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.15123
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Domains in SCOP 1.69: d1v0hx_

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1v0hX (X:)
    mrgshhhhhhgsgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdk
    gtktggpfgtikhpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtg
    gpevpfhpgredkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaah
    kersgfegpwtsnplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaaded
    affadyaeahqklselgfada
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0hX (X:)
    sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
    khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
    dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
    snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
    klselgfad