PDB entry 1v0h

View 1v0h on RCSB PDB site
Description: ascobate peroxidase from soybean cytosol in complex with salicylhydroxamic acid
Class: oxidoreductase
Keywords: oxidoreductase, heme peroxidase, peroxide scavenge, ascorbate peroxidase
Deposited on 2004-03-29, released 2004-06-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: ascorbate peroxidase
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0H (Start-11)
    • Uniprot Q43758 (12-End)
    Domains in SCOPe 2.08: d1v0hx1, d1v0hx2
  • Heterogens: HEM, NA, SHA, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1v0hX (X:)
    mrgshhhhhhgsgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdk
    gtktggpfgtikhpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtg
    gpevpfhpgredkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaah
    kersgfegpwtsnplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaaded
    affadyaeahqklselgfada
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0hX (X:)
    sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
    khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
    dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
    snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
    klselgfad