PDB entry 1v0e

View 1v0e on RCSB PDB site
Description: endosialidase of bacteriophage k1f
Class: hydrolase
Keywords: endosialidase, polysialic acid degradation, hydrolase, glycosidase.
Deposited on 2004-03-28, released 2004-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.16781
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-alpha-sialidase
    Species: COLIPHAGE K1F [TaxId:344021]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0E (0-0)
    • Uniprot Q858B1 (1-665)
    Domains in SCOPe 2.07: d1v0ea1, d1v0ea2
  • Chain 'B':
    Compound: endo-alpha-sialidase
    Species: COLIPHAGE K1F [TaxId:344021]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0E (0-0)
    • Uniprot Q858B1 (1-665)
    Domains in SCOPe 2.07: d1v0eb1, d1v0eb2
  • Chain 'C':
    Compound: endo-alpha-sialidase
    Species: COLIPHAGE K1F [TaxId:344021]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0E (0-0)
    • Uniprot Q858B1 (1-665)
    Domains in SCOPe 2.07: d1v0ec1, d1v0ec2
  • Chain 'D':
    Compound: endo-alpha-sialidase
    Species: COLIPHAGE K1F [TaxId:344021]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0E (0-0)
    • Uniprot Q858B1 (1-665)
    Domains in SCOPe 2.07: d1v0ed1, d1v0ed2
  • Chain 'E':
    Compound: endo-alpha-sialidase
    Species: COLIPHAGE K1F [TaxId:344021]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0E (0-0)
    • Uniprot Q858B1 (1-665)
    Domains in SCOPe 2.07: d1v0ee1, d1v0ee2
  • Chain 'F':
    Compound: endo-alpha-sialidase
    Species: COLIPHAGE K1F [TaxId:344021]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0E (0-0)
    • Uniprot Q858B1 (1-665)
    Domains in SCOPe 2.07: d1v0ef1, d1v0ef2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0eA (A:)
    sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
    yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
    dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
    rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
    ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
    dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
    sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
    yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
    npwtygdnsakdpfksdghpsdlycykmkigpdnrvsrdfrygavpnravpvffdtngvr
    tvpapmeftgdlglghvtirastssnirsevlmegeygfigksiptdnpagqriifcgge
    gtssttgaqitlyganntdsrrivyngdehlfqsadvkpyndnvtalggpsnrfttaylg
    snpivt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0eB (B:)
    sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
    yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
    dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
    rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
    ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
    dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
    sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
    yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
    npwtygdnsakdpfksdghpsdlycykmkigpdnrvsrdfrygavpnravpvffdtngvr
    tvpapmeftgdlglghvtirastssnirsevlmegeygfigksiptdnpagqriifcgge
    gtssttgaqitlyganntdsrrivyngdehlfqsadvkpyndnvtalggpsnrfttaylg
    snpivt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0eC (C:)
    sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
    yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
    dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
    rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
    ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
    dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
    sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
    yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
    npwtygdnsakdpfksdghpsdlycykmkigpdnrvsrdfrygavpnravpvffdtngvr
    tvpapmeftgdlglghvtirastssnirsevlmegeygfigksiptdnpagqriifcgge
    gtssttgaqitlyganntdsrrivyngdehlfqsadvkpyndnvtalggpsnrfttaylg
    snpivt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0eD (D:)
    sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
    yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
    dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
    rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
    ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
    dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
    sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
    yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
    npwtygdnsakdpfksdghpsdlycykmkigpdnrvsrdfrygavpnravpvffdtngvr
    tvpapmeftgdlglghvtirastssnirsevlmegeygfigksiptdnpagqriifcgge
    gtssttgaqitlyganntdsrrivyngdehlfqsadvkpyndnvtalggpsnrfttaylg
    snpivt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0eE (E:)
    sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
    yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
    dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
    rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
    ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
    dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
    sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
    yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
    npwtygdnsakdpfksdghpsdlycykmkigpdnrvsrdfrygavpnravpvffdtngvr
    tvpapmeftgdlglghvtirastssnirsevlmegeygfigksiptdnpagqriifcgge
    gtssttgaqitlyganntdsrrivyngdehlfqsadvkpyndnvtalggpsnrfttaylg
    snpivt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v0eF (F:)
    sakgdgvtddtaaltsalndtpvgqkingngktykvtslpdisrfintrfvyeripgqpl
    yyaseefvqgelfkitdtpyynawpqdkafvyenviyapymgsdrhgvsrlhvswvksgd
    dgqtwstpewltdlhpdyptvnyhcmsmgvcrnrlfamietrtlaknaltncalwdrpms
    rslhltggitkaanqryatihvpdhglfvgdfvnfsnsavtgvsgdmtvatvidkdnftv
    ltpnqqtsdlnnagknwhmgtsfhkspwrktdlglipsvtevhsfatidnngfamgyhqg
    dvaprevglfyfpdafnspsnyvrrqipseyepdasepcikyydgvlylitrgtrgdrlg
    sslhrsrdigqtweslrfphnvhhttlpfakvgddlimfgseraeneweagapddrykas
    yprtfyarlnvnnwnaddiewvnitdqiyqggivnsgvgvgsvvvkdnyiyymfggedhf
    npwtygdnsakdpfksdghpsdlycykmkigpdnrvsrdfrygavpnravpvffdtngvr
    tvpapmeftgdlglghvtirastssnirsevlmegeygfigksiptdnpagqriifcgge
    gtssttgaqitlyganntdsrrivyngdehlfqsadvkpyndnvtalggpsnrfttaylg
    snpivt