PDB entry 1v0d

View 1v0d on RCSB PDB site
Description: crystal structure of caspase-activated DNAse (cad)
Class: hydrolase
Keywords: hydrolase, nuclease, caspase-activated DNAse
Deposited on 2004-03-26, released 2004-05-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.218
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA fragmentation factor 40 kda subunit
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O54788 (Start-328)
      • conflict (108)
    Domains in SCOPe 2.07: d1v0da_
  • Heterogens: ZN, MG, PB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0dA (A:)
    mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
    dcfpglpndaelllltagetwhgyvsditrflsvfnephagviqaarqqlsdeqaplrqk
    lladllhhvsqnitaetreqdpswfeglesrfrnksgylryscesrirgylrevsaytsm
    vdeaaqeeylrvlgsmcqklksvqyngsyfdrgaeassrlctpegwfscqgpfdlescls
    khsinpygnresrilfstwnldhiiekkrtvvptlaeaiqdgrevnweyfysllftaenl
    klvhiachkktthklecdrsriyrpqtgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0dA (A:)
    vsditrflsvfnephagviqaarqqlsdeqaplrqklladllhhvsqnitaetreqdpsw
    feglesrfrnksgylryscesrirgylrevsaytsmvdeaaqeeylrvlgsmcqklksvq
    yngsyfdrgaeassrlctpegwfscqgpfdlesclskhsinpygnresrilfstwnldhi
    iekkrtvvptlaeaiqdgrevnweyfysllftaenlklvhiachkktthklecdrsriyr
    pqtgs