PDB entry 1v0c

View 1v0c on RCSB PDB site
Description: structure of aac(6')-ib in complex with kanamycin c and acetylcoa.
Deposited on 2008-03-20, released 2008-09-02
The last revision was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.179
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aac(6')-ib
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0C
      • engineered mutation (104)
      • engineered mutation (181)
    • Uniprot Q6SJ71 (Start-201)
  • Heterogens: ACO, KNC, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1v0cA (A:)
    gshmsnaktklgitkysivtnsndsvtlrlmtehdlamlyewlnrshivewwggeearpt
    ladvqeqylpsvlaqesvtpyiamlngepigyaqsyvalgsgdgwweeetdpgvrgidql
    lanasqlgkglgtklvralvellfndpevtkiqtdpspsnlraircyekagferqgtvtt
    pdgpavymvqtrqafertrsda
    

    Sequence, based on observed residues (ATOM records):
    >1v0cA (A:)
    dsvtlrlmtehdlamlyewlnrshivewwgarptladvqeqylpsvlaqesvtpyiamln
    gepigyaqsyvalgsgdgwweeetdpgvrgidqllanasqlgkglgtklvralvellfnd
    pevtkiqtdpspsnlraircyekagferqgtvttpdgpavymvqtrqafertrsda