PDB entry 1v0a

View 1v0a on RCSB PDB site
Description: family 11 carbohydrate-binding module of cellulosomal cellulase lic26a-cel5e of clostridium thermocellum
Class: hydrolase
Keywords: carbohydrate binding module, cellulosome, clostridium thermocellum, cellulose degradation, hydrolase, glycosidase
Deposited on 2004-03-25, released 2005-01-12
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.195
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase h
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V0A (170-End)
    • Uniprot P16218 (3-169)
    Domains in SCOPe 2.01: d1v0aa1
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0aA (A:)
    masavgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvysl
    pdgdwskwlkisfdiksvdgsaneirfmiaeksingvgdgehwvysitpdsswktieipf
    ssfrrrldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikligalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0aA (A:)
    savgekmlddfegvlnwgsysgegakvstkivsgktgngmevsytgttdgywgtvyslpd
    gdwskwlkisfdiksvaneirfmiaeksingvgdgehwvysitpdsswktieipfssfrr
    rldyqppgqdmsgtldldnidsihfmyannksgkfvvdnikligalehhh